Revision history of "Team:Edinburgh/crtB"

From 2008.igem.org

Diff selection: mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.

Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.
  • (cur | prev) 23:40, 29 October 2008 Andhi (Talk | contribs) (1,786 bytes) (New page: <div id="header">{{Template:Team:Edinburgh/Templates/Header}}</div> = ''crtB'' = === AMINO ACID SEQUENCE === MNNPSLLNHAVETMAVGSKSFATASKLFDAKTRRSVLMLYAWCR<br /> HCDDVIDDQTLGFQARQPALQTPEQ...)
Retrieved from "http://2008.igem.org/Team:Edinburgh/crtB"