"

 

From 2008.igem.org

Search for contributions

 Show contributions of new accounts only
 IP address or username: Namespace: all (Main) Talk User User talk 2008.igem.org 2008.igem.org talk File File talk MediaWiki MediaWiki talk Template Template talk Help Help talk Category Category talk

From year (and earlier): From month (and earlier): all January February March April May June July August September October November December

(Latest | Earliest) View (newer 50 | older 50) (20 | 50 | 100 | 250 | 500)

• 02:03, 30 October 2008 (diff | hist) Team:Edinburgh/Plan ‎ (→Assembly) (top)
• 02:03, 30 October 2008 (diff | hist) Team:Edinburgh/Plan ‎ (→Lemon flavour)
• 02:01, 30 October 2008 (diff | hist) Team:Edinburgh/Plan/Beta-Carotene ‎ (→Assembley) (top)
• 01:59, 30 October 2008 (diff | hist) Team:Edinburgh/Results/Glycogen4 ‎ (→Glycogen Assay 4 (Quantitative: Raman)) (top)
• 01:58, 30 October 2008 (diff | hist) Team:Edinburgh/Results/Glycogen3 ‎ (→Glycogen Assay 3 (Quantitative: Raman))
• 01:58, 30 October 2008 (diff | hist) Team:Edinburgh/Results ‎ (→Glycogenesis device)
• 01:57, 30 October 2008 (diff | hist) Team:Edinburgh/Results ‎ (→Starch synthesis device)
• 01:57, 30 October 2008 (diff | hist) Team:Edinburgh/Results ‎ (→Limonene synthase device)
• 01:56, 30 October 2008 (diff | hist) Team:Edinburgh/Results ‎ (→Cellulolysis device)
• 01:56, 30 October 2008 (diff | hist) Team:Edinbrugh/Results/PcstA-xylE ‎ (→Results)
• 01:55, 30 October 2008 (diff | hist) Team:Edinbrugh/Results/PcstA-xylE ‎ (→Background and Aims)
• 01:54, 30 October 2008 (diff | hist) Team:Edinburgh/Plan ‎ (→The chassis: E. coli vs. B. subtilis)
• 01:53, 30 October 2008 (diff | hist) Team:Edinburgh/Plan ‎ (→The chassis: E. coli vs. B. subtilis)
• 01:50, 30 October 2008 (diff | hist) Team:Edinburgh ‎ (→Further Considerations)
• 01:50, 30 October 2008 (diff | hist) Team:Edinburgh ‎ (→Further Considerations)
• 01:50, 30 October 2008 (diff | hist) Team:Edinburgh ‎ (→Further Considerations)
• 01:48, 30 October 2008 (diff | hist) Team:Edinburgh ‎ (→Introduction: Global problems)
• 01:45, 30 October 2008 (diff | hist) Team:Edinburgh ‎ (→Introduction: Global problems)
• 01:42, 30 October 2008 (diff | hist) Team:Edinburgh/Modelling ‎ (→Modelling)
• 01:41, 30 October 2008 (diff | hist) Template:Team:Edinburgh/Templates/Header ‎ (top)
• 01:41, 30 October 2008 (diff | hist) Template:Team:Edinburgh/Templates/Header ‎
• 01:39, 30 October 2008 (diff | hist) Team:Edinburgh/Parts ‎ (top)
• 01:18, 30 October 2008 (diff | hist) Team:Edinburgh/SU1 ‎ (→Primers) (top)
• 01:18, 30 October 2008 (diff | hist) Team:Edinburgh/SU1 ‎ (→SU1)
• 00:44, 30 October 2008 (diff | hist) File:Edinburgh-Team.jpg ‎ (uploaded a new version of "Image:Edinburgh-Team.jpg": The Edinburgh team at the UK iGEM meeting, Edinburgh, July 2008.) (top)
• 00:33, 30 October 2008 (diff | hist) Team:Edinburgh/Plan ‎ (→References)
• 00:23, 30 October 2008 (diff | hist) Team:Edinburgh/crtY ‎ (top)
• 00:23, 30 October 2008 (diff | hist) N Team:Edinburgh/crtY ‎ (New page: <div id="header">{{Template:Team:Edinburgh/Templates/Header}}</div> = ''cex'' = For better alignment see [https://static.igem.org/mediawiki/2008/c/c2/Edinburgh-cex.txt .txt file] === AMINO AC...)
• 00:22, 30 October 2008 (diff | hist) Team:Edinburgh/Plan ‎ (→Secondary Objective: The synthesis of β-carotene)
• 00:08, 30 October 2008 (diff | hist) Team:Edinburgh/appY ‎ (→appY) (top)
• 00:07, 30 October 2008 (diff | hist) N Team:Edinburgh/appY ‎ (New page: <div id="header">{{Template:Team:Edinburgh/Templates/Header}}</div> = ''appY'' = For better alignment see [https://static.igem.org/mediawiki/2008/c/c2/Edinburgh-cex.txt .txt file] === AMINO A...)
• 00:02, 30 October 2008 (diff | hist) Team:Edinburgh/Plan/Beta-Carotene ‎ (→Indirectly involved genes from E. coli)
• 00:01, 30 October 2008 (diff | hist) N Team:Edinburgh/dxs ‎ (New page: <div id="header">{{Template:Team:Edinburgh/Templates/Header}}</div> = ''dxs'' = === AMINO ACID SEQUENCE === msfdiakypt lalvdstqel rllpkeslpk lcdelrryll dsvsrssghf asglgtvelt<br /> valhy...) (top)
• 23:54, 29 October 2008 (diff | hist) Team:Edinburgh ‎ (→Further Considerations)
• 23:45, 29 October 2008 (diff | hist) Team:Edinburgh/crtI ‎ (→crtI) (top)
• 23:45, 29 October 2008 (diff | hist) N Team:Edinburgh/crtI ‎ (New page: <div id="header">{{Template:Team:Edinburgh/Templates/Header}}</div> = ''crtI'' = For better alignment see [https://static.igem.org/mediawiki/2008/c/c2/Edinburgh-cex.txt .txt file] === AMINO A...)
• 23:40, 29 October 2008 (diff | hist) N Team:Edinburgh/crtB ‎ (New page: <div id="header">{{Template:Team:Edinburgh/Templates/Header}}</div> = ''crtB'' = === AMINO ACID SEQUENCE === MNNPSLLNHAVETMAVGSKSFATASKLFDAKTRRSVLMLYAWCR<br /> HCDDVIDDQTLGFQARQPALQTPEQ...) (top)
• 23:37, 29 October 2008 (diff | hist) N Team:Edinburgh/crtE ‎ (New page: <div id="header">{{Template:Team:Edinburgh/Templates/Header}}</div> = ''crtE'' = === AMINO ACID SEQUENCE === mtvcakkhvh ltrdaaeqll adidrrldql lpvegerdvv gaamregala pgkrirpmll<br /> llta...) (top)
• 23:19, 29 October 2008 (diff | hist) N Team:Edinburgh/GBS1 ‎ (New page: <div id="header">{{Template:Team:Edinburgh/Templates/Header}}</div> = ''GBS1'' = For better alignment see [https://static.igem.org/mediawiki/2008/c/c2/Edinburgh-GBS1.txt .txt file] === AMINO ...) (top)
• 23:15, 29 October 2008 (diff | hist) N File:Edinburgh-GBS1.txt ‎ (top)
• 23:09, 29 October 2008 (diff | hist) Team:Edinburgh/glgC ‎ (→glgC) (top)
• 23:08, 29 October 2008 (diff | hist) N Team:Edinburgh/glgC ‎ (New page: <div id="header">{{Template:Team:Edinburgh/Templates/Header}}</div> = ''glgC'' = === Amino acid sequence == MVSLEKNDHL MLARQLPLKS VALILAGGRG TRLKDLTNKR AKPA<br /> VHFGGK FRIIDFALSN CINS...)
• 22:49, 29 October 2008 (diff | hist) N Team:Edinburgh/bglX ‎ (New page: <div id="header">{{Template:Team:Edinburgh/Templates/Header}}</div> = ''bglX'' = === AMINO ACID SEQUENCE === MKKITVLISIWLSAAAFFSCEKKTEAGSKPQAFDKEVQDLLKNMSLEEKAGQMTQIDI<br /> RNLLNNGYGNT...) (top)
• 22:37, 29 October 2008 (diff | hist) File:Edinburgh-CellLysisModelling.jpg ‎ (uploaded a new version of "Image:Edinburgh-CellLysisModelling.jpg") (top)
• 22:36, 29 October 2008 (diff | hist) File:Edinburgh-CellLysisModelling.jpg ‎ (uploaded a new version of "Image:Edinburgh-CellLysisModelling.jpg")
• 22:03, 29 October 2008 (diff | hist) N File:Edinburgh-CellLysisModelling.jpg ‎
• 21:45, 29 October 2008 (diff | hist) File:Edinburgh Flowchart.jpg ‎ (uploaded a new version of "Image:Edinburgh Flowchart.jpg") (top)
• 21:41, 29 October 2008 (diff | hist) File:Edinburgh Flowchart.jpg ‎ (uploaded a new version of "Image:Edinburgh Flowchart.jpg")
• 21:22, 29 October 2008 (diff | hist) Team:Edinburgh/Plan/Beta-Carotene ‎ (→β-carotene synthesis)
• 21:06, 29 October 2008 (diff | hist) Team:Edinburgh/Protocols ‎

(Latest | Earliest) View (newer 50 | older 50) (20 | 50 | 100 | 250 | 500)

• Atom 
• Special pages
• My preferences

• Privacy policy
• Disclaimers