Team:KULeuven/Literature
From 2008.igem.org
(→Interesting Reads) |
(→Interesting Reads) |
||
Line 21: | Line 21: | ||
suggesting that most of the enhanced cleavage properties can be attributed to the N-terminal tail (residues 1 to 29) of UmuDSt. | suggesting that most of the enhanced cleavage properties can be attributed to the N-terminal tail (residues 1 to 29) of UmuDSt. | ||
This region contains the cleavage site and not the active catalytic site of the protein, which leads us to conclude that UmuDSt is, in fact, cleaved more efficiently because it is a better substrate than UmuDEc. | This region contains the cleavage site and not the active catalytic site of the protein, which leads us to conclude that UmuDSt is, in fact, cleaved more efficiently because it is a better substrate than UmuDEc. | ||
+ | |||
+ | '''UmuD''' | ||
+ | http://bayesweb.wadsworth.org/binding_sites/umuD.html | ||
+ | |||
+ | |||
+ | '''Sequence of UmuD''' | ||
+ | http://www.expasy.ch/cgi-bin/get-entries?AC=P04153 | ||
+ | |||
+ | >P0AG12|UMUD_ECO57 Protein umuD - Escherichia coli O157:H7. | ||
+ | MLFIKPADLREIVTFPLFSDLVQCGFPSPAADYVEQRIDLNQLLIQHPSATYFVKASGDS | ||
+ | MIDGGISDGDLLIVDSAITASHGDIVIAAVDGEFTVKKLQLRPTVQLIPMNSAYSPITIS | ||
+ | SEDTLDVFGVVIHVVKAMR | ||
+ | >P0AG11|UMUD_ECOLI Protein umuD - Escherichia coli (strain K12). | ||
+ | MLFIKPADLREIVTFPLFSDLVQCGFPSPAADYVEQRIDLNQLLIQHPSATYFVKASGDS | ||
+ | MIDGGISDGDLLIVDSAITASHGDIVIAAVDGEFTVKKLQLRPTVQLIPMNSAYSPITIS | ||
+ | SEDTLDVFGVVIHVVKAMR | ||
+ | |||
'''Fast degrading GFP'''<br> | '''Fast degrading GFP'''<br> | ||
http://aem.asm.org/cgi/content/full/64/6/2240?view=long&pmid=9603842 | http://aem.asm.org/cgi/content/full/64/6/2240?view=long&pmid=9603842 |
Revision as of 14:00, 16 July 2008
Result:
To have a dropdown for your own team copy over all of the content below. It might be needed to adjust a thing or two. Comments have been added throughout the code what must be changed.
Inspirational websites:
- [http://javascript-array.com/scripts/simple_drop_down_menu/ Most basic dropdown menu, with no submenu's]
- [http://jquery.com/ The javascript library used to add effects and optimise the dropdown]
- [http://www.tyssendesign.com.au/articles/css/centering-a-dropdown-menu/ How to center a ul list effectively]
The dropdown has been created and developed by the KULeuven team.
<html> <style type="text/css"> #content {z-index:4;} #ddwrapper * {z-index:8 !important;} div#ddwrapper { margin:0; padding:0; height:28px; width:945px; /* change to adjust imperfections in width */ } div#ddnav { margin:0 auto; /* needed to center the dropdown */ padding:0; top:5px; /* width: 965px */ visibility:hidden; /* dropdown is hidden until properly initalised by javascript */ } div#ddtoggle { margin:0; position:fixed; right:2px; top:15px; height:10px; width:10px; z-index:100; } #ddnav ul { display:table-row; /* works only for firefox, later adjusted by javascript for IE */ margin:0 auto; padding:0; } #ddnav ul li { display:table-cell; /* works only for firefox, later adjusted by javascript for IE */ list-style:none; margin:0; padding:0 !important; border-right:1px solid #FFF; /* creates illusion of spacing between tabs */ } #ddnav ul li:last-child{border-right:none;} #ddnav a{ display:block; margin:0; padding:4px 14px; /* play with dimensions for size of tabs */ background-color:#075A90; /* background color for tabs */ color:#FFF !important; /* font color for text in tabs */ text-align:center; /* aligning for text in tabs */ text-decoration:none !important; font:bold 10pt Trebuchet MS; /* font properties for text in tabs */ outline:0; } #ddnav ul li a:hover {background-color:#99CCFF;}/* background color for tabs on mouseover */ #ddnav li a:active {outline:none;} /* remove standard dotted border for links when clicked (IE) */ #ddnav li a:focus {-moz-outline-style:none;} /* remove standard dotted border for links when clicked (FF) */ #ddnav div { display:none; position:absolute; width:9em; background-color:#000; /* bug solution, do not change ! */ border:1px solid #5970B2; /* border color for dropdown menus */ opacity:0.9; /* transparancy of the dropdown menus (FF) */ filter:alpha(opacity=90); /* transparancy of the dropdown menus (IE) */ } #ddnav div a { display:block; padding:5px 10px; /* play with dimensions of block element in dropdown menus */ position:relative; font:normal 8pt arial; /* font properties for text in dropdown menus */ text-align:left; /* aligning of text in dropdown menus */ cursor:pointer; } #ddnav div a:hover, #ddnav span a:hover {color:#000 !important;} /* text color on mouseover */ #ddnav span div { position:relative; border:none; border-bottom:2px groove #5970B2; /* separator for submenus, groove does not work in FF */ opacity:1.0; /* avoid stacking transparancy for submenus (FF) */ filter:alpha(opacity=100); /* avoid stacking transparancy for submenus (IE) */ } /* may want to upload the following pictures to a new location */ .expand {background: url('https://static.igem.org/mediawiki/2008/e/ef/Icon-expand.png') no-repeat 95% 50%;} .collapse {background: url('https://static.igem.org/mediawiki/2008/c/cd/Icon-collapse.png') no-repeat 95% 50%;} .docked {background: #99ccff url("https://static.igem.org/mediawiki/2008/6/62/Ddnavundock.png") no-repeat 50% 50%;} .undocked {background: #99ccff url("https://static.igem.org/mediawiki/2008/e/e4/Ddnavdock.png") no-repeat 50% 50%;} </style> <!-- IMPORTANT: save following script under a personalized webspace or download the library at www.jquery.com --> <script type="text/javascript" src="http://student.kuleuven.be/~s0173901/wiki/js/jquery.js"></script> <script type="text/javascript"> function ddnav() { $('#ddnav ul li').hover( function () { $(this).find('div:first').css('display','block');}, function () { $(this).find('div:first').css('display','none');} ); } function ddnavsub() { $('#ddnav span > a').toggle( function () { $(this).removeClass("#ddnav expand").addClass("#ddnav collapse"); $(this).parent().find('div:first').slideDown('fast'); $(this).hover( function (){$(this).css('background-color','#99AAFF');}, function (){$(this).css('background-color','#99AAFF');});}, function () { $(this).removeClass("#ddnav collapse").addClass("#ddnav expand"); $(this).parent().find('div:first').css('display','none'); $(this).hover( function (){$(this).css('background-color','#99CCFF');}, function (){$(this).css('background-color','#075A90');});} ).addClass("#ddnav expand"); } /* If you wish to omit the docking feature, remove following function ddtoggle() */ function ddtoggle() { $('#ddtoggle').toggle( function () { $(this).removeClass('undocked').addClass('docked'); $('#ddnav').css('position','fixed');}, function () { $(this).removeClass('docked').addClass('undocked'); $('#ddnav').css('position','static');} ); } function ddalign() { var _windowWidth = $(window).width(); var _leftOffset = (_windowWidth - 965)/2; $('div#ddnav').css('left',_leftOffset); } function ddmsie() { $('#ddnav a').hover( function () {$(this).css('background-color','#99ccff');}, function () {$(this).css('background-color','#075a90');} ); /* toggle doesn't work yet */ $('#ddtoggle').css('display','none'); $('#ddnav ul').css('display','inline-block'); $('#ddnav ul li').css('display','inline'); $('#ddnav ul li').css('position','relative'); $('#ddnav ul li>a').css('display','inline-block'); $('#ddnav ul li>a').css('margin-right','-4px'); $('#ddnav div').css('left','0'); $('#ddnav div').css('top','100%'); $('#ddnav span div').css('top','0'); } function ddmozilla() { ddtoggle(); $(window).bind('resize', function() {ddalign();}); } $(function () { ddnav(); ddnavsub(); if(jQuery.browser.msie) ddmsie(); if(jQuery.browser.mozilla) ddmozilla(); $('#ddnav').css('visibility','visible'); }); </script> <!-- If you wish to omit the docking feature omit following line (div with id ddtoggle) --> <div id="ddtoggle" class="undocked"></div> <div id="ddwrapper"> <!-- Here the actual links are defined, simply replace with your own links in the appropriate sections --> <div id="ddnav" align="center"> <ul> <li> <a href="https://2008.igem.org/Team:KULeuven">Home</a> </li> <li> <a>The Team</a> <div> <a href="https://2008.igem.org/Team:KULeuven/Team/LabsandGroups">Research Labs and Groups</a> <a href="https://2008.igem.org/Team:KULeuven/Team/Students">Students</a> <a href="https://2008.igem.org/Team:KULeuven/Team/Instructors">Instructors</a> <a href="https://2008.igem.org/Team:KULeuven/Team/Advisors">Advisors</a> <a href="https://2008.igem.org/Team:KULeuven/Team/Pictures">Pictures</a> </div> </li> <li> <a>The Project</a> <div> <a href="https://2008.igem.org/Team:KULeuven/Project">Summary</a> <span> <a>Components</a> <div> <a href="https://2008.igem.org/Team:KULeuven/Project/Input">Input</a> <a href="https://2008.igem.org/Team:KULeuven/Project/Output">Output</a> <a href="https://2008.igem.org/Team:KULeuven/Project/Filter">Filter</a> <a href="https://2008.igem.org/Team:KULeuven/Project/Inverter">Invertimer</a> <a href="https://2008.igem.org/Team:KULeuven/Project/Reset">Reset</a> <a href="https://2008.igem.org/Team:KULeuven/Project/CellDeath">Cell Death</a> <a href="https://2008.igem.org/Team:KULeuven/Project/Memory">Memory</a> </div> </span> <a href="https://2008.igem.org/Team:KULeuven/Evaluation">End Evaluation</a> <a href="https://2008.igem.org/Team:KULeuven/Literature">Literature</a> <a href="https://2008.igem.org/Team:KULeuven/Brainstorm">Brainstorm</a> </div> </li> <li> <a>Ethics</a> <div> </div> </li> <li> <a>Submitted Parts</a> <div> <a href="https://2008.igem.org/Team:KULeuven/Parts">Listing</a> <a href="http://partsregistry.org/cgi/partsdb/pgroup.cgi?pgroup=iGEM2008&group=KULeuven">Sandbox</a> </div> </li> <li> <a>Modeling</a> <div> <a href="https://2008.igem.org/Team:KULeuven/Model/Overview">Overview</a> <a href="https://2008.igem.org/Team:KULeuven/Model/KineticConstants">Kinetic Constants</a> <span> <a>Components</a> <div> <a href="https://2008.igem.org/Team:KULeuven/Model/Output">Output</a> <a href="https://2008.igem.org/Team:KULeuven/Model/Filter">Filter</a> <a href="https://2008.igem.org/Team:KULeuven/Model/Inverter">Invertimer</a> <a href="https://2008.igem.org/Team:KULeuven/Model/Reset">Reset</a> <a href="https://2008.igem.org/Team:KULeuven/Model/CellDeath">Cell Death</a> <a href="https://2008.igem.org/Team:KULeuven/Model/Memory">Memory</a> </div> </span> <a href="https://2008.igem.org/Team:KULeuven/Model/FullModel">Full Model</a> <a href="https://2008.igem.org/Team:KULeuven/Model/Sensitivity">Sensitivity Analysis</a> <a href="https://2008.igem.org/Team:KULeuven/Model/MultiCell">Multi-cell Model</a> <a href="https://2008.igem.org/Team:KULeuven/Model/Diffusion">Diffusion</a> </div> </li> <li> <a>Data Analysis</a> <div> <a href="https://2008.igem.org/Team:KULeuven/Data/Overview">Overview</a> <span> <a>New Parts</a> <div> <a href="https://2008.igem.org/Team:KULeuven/Data/GFP">GFP (LVA-tag)</a> <a href="https://2008.igem.org/Team:KULeuven/Data/T7">T7 (UmuD-tag)</a> <a href="https://2008.igem.org/Team:KULeuven/Data/Antisense">Antisense LuxI</a> <a href="https://2008.igem.org/Team:KULeuven/Data/ccdB">Celldeath (ccdB)</a> <a href="https://2008.igem.org/Team:KULeuven/Data/HybridProm">Hybrid Promotor</a> </div> </span> <span> <a>Components</a> <div> <a href="https://2008.igem.org/Team:KULeuven/Data/Input">Input</a> <a href="https://2008.igem.org/Team:KULeuven/Data/Output">Output</a> <a href="https://2008.igem.org/Team:KULeuven/Data/Filter">Filter</a> <a href="https://2008.igem.org/Team:KULeuven/Data/Inverter">Invertimer</a> <a href="https://2008.igem.org/Team:KULeuven/Data/Reset">Reset</a> <a href="https://2008.igem.org/Team:KULeuven/Data/CellDeath">Cell Death</a> <a href="https://2008.igem.org/Team:KULeuven/Data/Memory">Memory</a> </div> </span> <a href="https://2008.igem.org/Team:KULeuven/Data/FullModel">Full Model</a> </div> </li> <li> <a>Software</a> <div> <a href="https://2008.igem.org/Team:KULeuven/Software/MultiCell">Multi-cell Toolbox</a> <a href="https://2008.igem.org/Team:KULeuven/Software/Simbiology2LaTeX">Simbiology2LaTeX Toolbox</a> </div> </li> <li> <a>Notebook</a> <div> <a href="https://2008.igem.org/Team:KULeuven/Meeting_Calendar">Calendar</a> <a href="https://2008.igem.org/Team:KULeuven/SummerHolidays">Summer Holidays</a> <span> <a>Reports</a> <div> <a href="https://2008.igem.org/Team:KULeuven/Meeting Reports">Daily</a> <a href="https://2008.igem.org/Team:KULeuven/Weekly Meetings">Weekly</a> </div> </span> <span> <a>Lab Data</a> <div> <a href="https://2008.igem.org/Team:KULeuven/Freezer">Freezer</a> <a href="https://2008.igem.org/Team:KULeuven/Primers">Primers</a> <a href="https://2008.igem.org/Team:KULeuven/Ligation">Ligation</a> </div> </span> <a href="https://2008.igem.org/Team:KULeuven/Tools">Tools</a> <a href="https://2008.igem.org/Team:KULeuven/Press">Press</a> <a href="https://2008.igem.org/Team:KULeuven/Guestbook">Guestbook</a> </div> </li> </ul> </div> </div> </html>
Interesting Reads
N-terminal degradation tags (needed for T7, Lon protease based)UmuD
http://www.genesdev.org/cgi/content/full/12/24/3889
One obvious test of this hypothesis is an ability of these sequences to impart instability on an otherwise stable protein. To test this hypothesis, we constructed a plasmid (pKSD-PRP) expressing a chimeric gene encoding the first 40 amino acids of UmuD fused to a 7-amino-acid linker joined to the entire Streptoalloteichus hindustanus Ble protein. The S. hindustanus ble gene encodes a small, stable protein that provides resistance to the antibiotics of the phleomycin family. Furthermore, subsequent experimentation demonstrated that residues 1-29 of UmuD are sufficient to impart Lon recognition and degradation of the PRP similar to that seen with the 40-amino-acid fusion. The amino-terminal 40 amino acids of UmuD are sufficient to target the PRP for degradation by Lon in vivo. In contrast, the UmuD-PRP fusion is unstable in the lon+ background and displays a half-life of ~9 min.
Regulation of UmuD cleavage: role of the amino-terminal tail
http://www.sciencedirect.com/science?_ob=ArticleURL&_udi=B6WK7-45S4955-4N&_user=877992&_rdoc=1&_fmt=&_orig=search&_sort=d&view=c&_acct=C000047079&_version=1&_urlVersion=0&_userid=877992&md5=5cf7322e67183cefdf18521b41317a32
By constructing chimeric UmuD proteins, we determined that the amino-terminal tail of the UmuD proteins proximal to the Cys24-Gly25 cleavage site is mainly responsible for the difference in UmuDStand UmuDEc cleavage rates. suggesting that most of the enhanced cleavage properties can be attributed to the N-terminal tail (residues 1 to 29) of UmuDSt. This region contains the cleavage site and not the active catalytic site of the protein, which leads us to conclude that UmuDSt is, in fact, cleaved more efficiently because it is a better substrate than UmuDEc.
UmuD http://bayesweb.wadsworth.org/binding_sites/umuD.html
Sequence of UmuD
http://www.expasy.ch/cgi-bin/get-entries?AC=P04153
>P0AG12|UMUD_ECO57 Protein umuD - Escherichia coli O157:H7. MLFIKPADLREIVTFPLFSDLVQCGFPSPAADYVEQRIDLNQLLIQHPSATYFVKASGDS MIDGGISDGDLLIVDSAITASHGDIVIAAVDGEFTVKKLQLRPTVQLIPMNSAYSPITIS SEDTLDVFGVVIHVVKAMR >P0AG11|UMUD_ECOLI Protein umuD - Escherichia coli (strain K12). MLFIKPADLREIVTFPLFSDLVQCGFPSPAADYVEQRIDLNQLLIQHPSATYFVKASGDS MIDGGISDGDLLIVDSAITASHGDIVIAAVDGEFTVKKLQLRPTVQLIPMNSAYSPITIS SEDTLDVFGVVIHVVKAMR
Fast degrading GFP
http://aem.asm.org/cgi/content/full/64/6/2240?view=long&pmid=9603842