"
User contributions
From 2008.igem.org
(Latest | Earliest) View (newer 50 | older 50) (20 | 50 | 100 | 250 | 500)
- 02:39, 30 October 2008 (diff | hist) User:Wenhong (top)
- 02:38, 30 October 2008 (diff | hist) User:Ariel (top)
- 02:38, 30 October 2008 (diff | hist) User:Ariel
- 02:38, 30 October 2008 (diff | hist) User:Ariel
- 02:34, 30 October 2008 (diff | hist) User:Omarings (top)
- 02:33, 30 October 2008 (diff | hist) Team:Edinburgh/Team/Yan (top)
- 02:33, 30 October 2008 (diff | hist) Team:Edinburgh/Team/Yan
- 02:30, 30 October 2008 (diff | hist) Team:Edinburgh/ELSI (top)
- 02:25, 30 October 2008 (diff | hist) Team:Edinburgh/ELSI (→Cultural, economic and environmental concerns)
- 02:21, 30 October 2008 (diff | hist) Team:Edinburgh/Protocols/Bacillobricks (top)
- 02:21, 30 October 2008 (diff | hist) Team:Edinburgh/Protocols/BABEL (top)
- 02:20, 30 October 2008 (diff | hist) Team:Edinburgh/Protocols/MABEL (top)
- 02:20, 30 October 2008 (diff | hist) Team:Edinburgh/Protocols/Edinbrick1 (top)
- 02:14, 30 October 2008 (diff | hist) N Team:Edinburgh/Protocols/Bacillobricks (New page: '''Return to Protocols Page''' =Bacillobricks: Introduction of BioBricks<sup>TM</sup> into ''Bacillus subtilis''= ''Bacillus subtilis'' is potentially superi...)
- 02:14, 30 October 2008 (diff | hist) Team:Edinburgh/Protocols (top)
- 02:13, 30 October 2008 (diff | hist) N Team:Edinburgh/Protocols/BABEL (New page: '''Return to Protocols page''' =BABEL: BioBrick<sup>TM</sup> Assembly with Blunt-Ended Ligation= BABEL is an alternative, restriction enzyme-free method for ...)
- 02:13, 30 October 2008 (diff | hist) Team:Edinburgh/Protocols
- 02:12, 30 October 2008 (diff | hist) N Team:Edinburgh/Protocols/MABEL (New page: '''Return to Protocols page''' =Site-drected mutagenesis using the MABEL protocol= MABEL (Mutagenesis with Blunt-Ended Ligation) is a fast, cheap, simple and...)
- 02:12, 30 October 2008 (diff | hist) Team:Edinburgh/Protocols
- 02:12, 30 October 2008 (diff | hist) Team:Edinburgh/Results/MABEL (top)
- 02:11, 30 October 2008 (diff | hist) Team:Edinburgh/Results/Bacillobricks (top)
- 02:09, 30 October 2008 (diff | hist) Team:Edinburgh/Results/BABEL (top)
- 02:07, 30 October 2008 (diff | hist) Team:Edinburgh/Results/MABEL
- 02:05, 30 October 2008 (diff | hist) Team:Edinburgh/Protocols/Edinbrick1
- 02:05, 30 October 2008 (diff | hist) N Team:Edinburgh/Protocols/Edinbrick1 (New page: '''return to Protocols page''' =Use of Edinbrick1 in preparation of BioBricks<sup>TM</sup> from PCR products= Edinbrick1 was developed by the Edinburgh 2006 ...)
- 02:04, 30 October 2008 (diff | hist) Team:Edinburgh/Protocols
- 02:03, 30 October 2008 (diff | hist) Team:Edinburgh/Results/Edinbrick1 (top)
- 02:03, 30 October 2008 (diff | hist) Team:Edinburgh/Protocols
- 02:02, 30 October 2008 (diff | hist) Team:Edinburgh/Results/Glycogen3 (top)
- 02:01, 30 October 2008 (diff | hist) Team:Edinburgh/Results/Glycogen2 (top)
- 02:01, 30 October 2008 (diff | hist) Team:Edinbrugh/Results/PcstA-xylE (top)
- 02:00, 30 October 2008 (diff | hist) Team:Edinburgh/Results (top)
- 01:55, 30 October 2008 (diff | hist) Team:Edinburgh/ISO2 (top)
- 01:40, 30 October 2008 (diff | hist) Team:Edinburgh/ISO2
- 01:17, 30 October 2008 (diff | hist) N Team:Edinburgh/ISO2 (New page: <div id="header">{{Template:Team:Edinburgh/Templates/Header}}</div> = ''ISO2'' = === Amino Acid Sequence === MASSLPAPPASPSSSWRGLTPRCPPPRCGPLLARAAARSYRYRFRTDDDG<br/> VVDVAVAGKDGDAGYVVAIE...)
- 01:04, 30 October 2008 (diff | hist) N Team:Edinburgh/SU1 (New page: <div id="header">{{Template:Team:Edinburgh/Templates/Header}}</div> = ''SU1'' = === Amino Acid Sequence === MAQQLPCVSSPRPlLAvPAGRWRAGvRGRPNvAGlGRGRlSLHAAAARPv<br/> AEAvQAEEDDDDDDEEvAEER...)
- 00:40, 30 October 2008 (diff | hist) Team:Edinburgh/Results (→Lycopene generator)
- 00:39, 30 October 2008 (diff | hist) Team:Edinburgh/Results (→Cellulolysis device)
- 00:38, 30 October 2008 (diff | hist) Team:Edinbrugh/Results/PcstA-xylE (→Procedure)
- 00:37, 30 October 2008 (diff | hist) Team:Edinbrugh/Results/PcstA-xylE
- 00:36, 30 October 2008 (diff | hist) Team:Edinburgh/Results
- 00:34, 30 October 2008 (diff | hist) Template:Team:Edinburgh/Templates/notebook-entry/header (top)
- 00:33, 30 October 2008 (diff | hist) Template:Team:Edinburgh/Templates/notebook-entry/header
- 00:31, 30 October 2008 (diff | hist) Template:Team:Edinburgh/Templates/notebook-entry/header
- 00:30, 30 October 2008 (diff | hist) Edinburgh/Week 17 (top)
- 00:26, 30 October 2008 (diff | hist) Team:Edinburgh/Notebook (top)
- 00:25, 30 October 2008 (diff | hist) Team:Edinburgh/Notebook
- 00:25, 30 October 2008 (diff | hist) Edinburgh/Notebook/Plates (top)
- 00:19, 30 October 2008 (diff | hist) Edinburgh/Notebook/Minipreps (top)
- 00:03, 30 October 2008 (diff | hist) Edinburgh/Notebook/Maxipreps (top)
(Latest | Earliest) View (newer 50 | older 50) (20 | 50 | 100 | 250 | 500)
